WDR33 antibody (70R-6952)

Rabbit polyclonal WDR33 antibody raised against the N terminal of WDR33

Synonyms Polyclonal WDR33 antibody, Anti-WDR33 antibody, WDC146 antibody, FLJ11294 antibody, Wd Repeat Domain 33 antibody, WDR 33, WDR-33 antibody, WDR33, WDR-33, WDR 33 antibody
Specificity WDR33 antibody was raised against the N terminal of WDR33
Cross Reactivity Human
Applications WB
Immunogen WDR33 antibody was raised using the N terminal of WDR33 corresponding to a region with amino acids IWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTTKFVRTSTNKVKC
Assay Information WDR33 Blocking Peptide, catalog no. 33R-4214, is also available for use as a blocking control in assays to test for specificity of this WDR33 antibody

Images

Western Blot analysis using WDR33 antibody (70R-6952)

WDR33 antibody (70R-6952) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR33 antibody (70R-6952) | WDR33 antibody (70R-6952) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors