WDR4 antibody (70R-2223)

Rabbit polyclonal WDR4 antibody raised against the N terminal of WDR4

Synonyms Polyclonal WDR4 antibody, Anti-WDR4 antibody, WDR-4 antibody, WDR 4, Wd Repeat Domain 4 antibody, WDR-4, WDR 4 antibody, TRM82 antibody, WDR4
Specificity WDR4 antibody was raised against the N terminal of WDR4
Cross Reactivity Human
Applications WB
Immunogen WDR4 antibody was raised using the N terminal of WDR4 corresponding to a region with amino acids FIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRL
Assay Information WDR4 Blocking Peptide, catalog no. 33R-2940, is also available for use as a blocking control in assays to test for specificity of this WDR4 antibody

Western Blot analysis using WDR4 antibody (70R-2223)

WDR4 antibody (70R-2223) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR4 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using WDR4 antibody (70R-2223) | WDR4 antibody (70R-2223) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors