WDR40A antibody (70R-3536)

Rabbit polyclonal WDR40A antibody raised against the middle region of WDR40A

Synonyms Polyclonal WDR40A antibody, Anti-WDR40A antibody, KIAA1892 antibody, WDR 40 antibody, WDR-40 antibody, Wd Repeat Domain 40A antibody, MGC1058 antibody, WDR40, WDR 40, DKFZp434O125 antibody, WDR-40, TCC52 antibody
Specificity WDR40A antibody was raised against the middle region of WDR40A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WDR40A antibody was raised using the middle region of WDR40A corresponding to a region with amino acids TKSDARHNVSRVPVYAHITHKALKDIPKEDTNPDNCKVRALAFNNKNKEL
Assay Information WDR40A Blocking Peptide, catalog no. 33R-9149, is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Images

Western Blot analysis using WDR40A antibody (70R-3536)

WDR40A antibody (70R-3536) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR40A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene was identified by isolating cDNA from a size-fractionated library derived from brain in an attempt to characterize genes encoding large proteins. The function of the protein encoded by this gene has not yet been determined.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR40A antibody (70R-3536) | WDR40A antibody (70R-3536) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors