WDR49 antibody (70R-3399)

Rabbit polyclonal WDR49 antibody raised against the C terminal of WDR49

Synonyms Polyclonal WDR49 antibody, Anti-WDR49 antibody, WDR 49, WDR-49 antibody, WDR49, Wd Repeat Domain 49 antibody, FLJ33620 antibody, WDR 49 antibody, WDR-49
Specificity WDR49 antibody was raised against the C terminal of WDR49
Cross Reactivity Human
Applications WB
Immunogen WDR49 antibody was raised using the C terminal of WDR49 corresponding to a region with amino acids ACSFPKSQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKA
Assay Information WDR49 Blocking Peptide, catalog no. 33R-1080, is also available for use as a blocking control in assays to test for specificity of this WDR49 antibody

Images

Western Blot analysis using WDR49 antibody (70R-3399)

WDR49 antibody (70R-3399) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR49 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR49 antibody (70R-3399) | WDR49 antibody (70R-3399) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors