WDR66 antibody (70R-3677)

Rabbit polyclonal WDR66 antibody raised against the N terminal of WDR66

Synonyms Polyclonal WDR66 antibody, Anti-WDR66 antibody, FLJ39783 antibody, Wd Repeat Domain 66 antibody, WDR-66 antibody, MGC33630 antibody, WDR 66 antibody, WDR 66, WDR-66, WDR66
Specificity WDR66 antibody was raised against the N terminal of WDR66
Cross Reactivity Human
Applications WB
Immunogen WDR66 antibody was raised using the N terminal of WDR66 corresponding to a region with amino acids GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQSKAGISRESLV
Assay Information WDR66 Blocking Peptide, catalog no. 33R-3234, is also available for use as a blocking control in assays to test for specificity of this WDR66 antibody


Western Blot analysis using WDR66 antibody (70R-3677)

WDR66 antibody (70R-3677) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 130 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR66 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR66 antibody (70R-3677) | WDR66 antibody (70R-3677) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors