WDR77 antibody (70R-2042)

Rabbit polyclonal WDR77 antibody raised against the N terminal of WDR77

Synonyms Polyclonal WDR77 antibody, Anti-WDR77 antibody, Wd Repeat Domain 77 antibody, MEP50 antibody, RP11-552M11.3 antibody, WDR 77 antibody, MGC2722 antibody, WDR77, WDR-77 antibody, WDR 77, HKMT1069 antibody, WDR-77, Nbla10071 antibody
Specificity WDR77 antibody was raised against the N terminal of WDR77
Cross Reactivity Human
Applications WB
Immunogen WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS
Assay Information WDR77 Blocking Peptide, catalog no. 33R-6364, is also available for use as a blocking control in assays to test for specificity of this WDR77 antibody

Images

Western Blot analysis using WDR77 antibody (70R-2042)

WDR77 antibody (70R-2042) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR77 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR77 antibody (70R-2042) | WDR77 antibody (70R-2042) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors