WDR89 antibody (70R-3244)

Rabbit polyclonal WDR89 antibody raised against the middle region of WDR89

Synonyms Polyclonal WDR89 antibody, Anti-WDR89 antibody, C14orf150 antibody, MSTP050 antibody, WDR 89 antibody, WDR 89, MGC9907 antibody, WDR-89, Wd Repeat Domain 89 antibody, WDR-89 antibody, WDR89
Specificity WDR89 antibody was raised against the middle region of WDR89
Cross Reactivity Human
Applications WB
Immunogen WDR89 antibody was raised using the middle region of WDR89 corresponding to a region with amino acids TVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQR
Assay Information WDR89 Blocking Peptide, catalog no. 33R-9370, is also available for use as a blocking control in assays to test for specificity of this WDR89 antibody


Western Blot analysis using WDR89 antibody (70R-3244)

WDR89 antibody (70R-3244) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR89 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of WDR89 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR89 antibody (70R-3244) | WDR89 antibody (70R-3244) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors