WDTC1 antibody (70R-3541)

Rabbit polyclonal WDTC1 antibody raised against the N terminal of WDTC1

Synonyms Polyclonal WDTC1 antibody, Anti-WDTC1 antibody, WDTC1, Wd And Tetratricopeptide Repeats 1 antibody, RP11-4K3__A.1 antibody, WDTC 1, KIAA1037 antibody, WDTC-1, WDTC 1 antibody, WDTC-1 antibody, ADP antibody
Specificity WDTC1 antibody was raised against the N terminal of WDTC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVN
Assay Information WDTC1 Blocking Peptide, catalog no. 33R-7230, is also available for use as a blocking control in assays to test for specificity of this WDTC1 antibody

Images

Western Blot analysis using WDTC1 antibody (70R-3541)

WDTC1 antibody (70R-3541) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDTC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDTC1 contains 2 TPR repeats and 7 WD repeats. WDTC1, the ortholog of Drosophila Adipose Gene, associates with human obesity, modulated by MUFA intake.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDTC1 antibody (70R-3541) | WDTC1 antibody (70R-3541) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors