WFDC1 antibody (70R-3978)

Rabbit polyclonal WFDC1 antibody raised against the middle region of WFDC1

Synonyms Polyclonal WFDC1 antibody, Anti-WFDC1 antibody, WFDC-1, Wap Four-Disulfide Core Domain 1 antibody, WFDC1, WFDC 1 antibody, PS20 antibody, WFDC 1, WFDC-1 antibody
Specificity WFDC1 antibody was raised against the middle region of WFDC1
Cross Reactivity Human
Applications WB
Immunogen WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
Assay Information WFDC1 Blocking Peptide, catalog no. 33R-9410, is also available for use as a blocking control in assays to test for specificity of this WFDC1 antibody


Western Blot analysis using WFDC1 antibody (70R-3978)

WFDC1 antibody (70R-3978) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WFDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WFDC1 antibody (70R-3978) | WFDC1 antibody (70R-3978) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors