WIPF2 antibody (70R-4505)

Rabbit polyclonal WIPF2 antibody raised against the middle region of WIPF2

Synonyms Polyclonal WIPF2 antibody, Anti-WIPF2 antibody, WICH antibody, Was/Wasl Interacting Protein Family Member 2 antibody, WIPF-2, WIPF2, WIPF-2 antibody, WIPF 2, WIPF 2 antibody, WIRE antibody
Specificity WIPF2 antibody was raised against the middle region of WIPF2
Cross Reactivity Human
Applications WB
Immunogen WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP
Assay Information WIPF2 Blocking Peptide, catalog no. 33R-1041, is also available for use as a blocking control in assays to test for specificity of this WIPF2 antibody

Images

Western Blot analysis using WIPF2 antibody (70R-4505)

WIPF2 antibody (70R-4505) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WIPF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WIPF2 antibody (70R-4505) | WIPF2 antibody (70R-4505) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors