WIPI1 antibody (70R-4358)

Rabbit polyclonal WIPI1 antibody raised against the N terminal of WIPI1

Synonyms Polyclonal WIPI1 antibody, Anti-WIPI1 antibody, WIPI49 antibody, WIPI-1, Wd Repeat Domain Phosphoinositide Interacting 1 antibody, WIPI-1 antibody, ATG18 antibody, WIPI1, WIPI 1 antibody, FLJ10055 antibody, WIPI 1
Specificity WIPI1 antibody was raised against the N terminal of WIPI1
Cross Reactivity Human
Applications WB
Immunogen WIPI1 antibody was raised using the N terminal of WIPI1 corresponding to a region with amino acids AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN
Assay Information WIPI1 Blocking Peptide, catalog no. 33R-1237, is also available for use as a blocking control in assays to test for specificity of this WIPI1 antibody


Western Blot analysis using WIPI1 antibody (70R-4358)

WIPI1 antibody (70R-4358) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WIPI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WIPI1 antibody (70R-4358) | WIPI1 antibody (70R-4358) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors