WNK3 antibody (70R-5768)

Rabbit polyclonal WNK3 antibody raised against the N terminal of WNK3

Synonyms Polyclonal WNK3 antibody, Anti-WNK3 antibody, WNK3, WNK 3 antibody, WNK-3, WNK 3, WNK-3 antibody, Wnk Lysine Deficient Protein Kinase 3 antibody, KIAA1566 antibody, PRKWNK3 antibody
Specificity WNK3 antibody was raised against the N terminal of WNK3
Cross Reactivity Human,Mouse
Applications WB
Immunogen WNK3 antibody was raised using the N terminal of WNK3 corresponding to a region with amino acids WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV
Assay Information WNK3 Blocking Peptide, catalog no. 33R-10032, is also available for use as a blocking control in assays to test for specificity of this WNK3 antibody

Images

Western Blot analysis using WNK3 antibody (70R-5768)

WNK3 antibody (70R-5768) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 192 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the 'with no lysine' (WNK) kinase family, such as WNK3, are serine-threonine protein kinases that lack the almost invariant catalytic lysine in subdomain II, which is important for binding ATP in the catalytic site.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WNK3 antibody (70R-5768) | WNK3 antibody (70R-5768) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors