WNT1 antibody (70R-7124)

Rabbit polyclonal WNT1 antibody raised against the middle region of WNT1

Synonyms Polyclonal WNT1 antibody, Anti-WNT1 antibody, WNT 1 antibody, Wingless-Type Mmtv Integration Site Family Member 1 antibody, INT1 antibody, WNT-1 antibody, WNT 1, WNT1, WNT-1
Specificity WNT1 antibody was raised against the middle region of WNT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WNT1 antibody was raised using the middle region of WNT1 corresponding to a region with amino acids FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV
Assay Information WNT1 Blocking Peptide, catalog no. 33R-2912, is also available for use as a blocking control in assays to test for specificity of this WNT1 antibody

Images

Western Blot analysis using WNT1 antibody (70R-7124)

WNT1 antibody (70R-7124) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT1 is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT1 is very conserved in evolution, and it is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WNT1 antibody (70R-7124) | WNT1 antibody (70R-7124) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors