WNT10B antibody (70R-5288)

Rabbit polyclonal WNT10B antibody raised against the middle region of WNT10B

Synonyms Polyclonal WNT10B antibody, Anti-WNT10B antibody, WNTB 10, WNT-12 antibody, WNTB-10, WNT10B, WNTB-10 antibody, WNTB 10 antibody, Wingless-Type Mmtv Integration Site Family Member 10B antibody
Specificity WNT10B antibody was raised against the middle region of WNT10B
Cross Reactivity Human,Mouse
Applications WB
Immunogen WNT10B antibody was raised using the middle region of WNT10B corresponding to a region with amino acids GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
Assay Information WNT10B Blocking Peptide, catalog no. 33R-3618, is also available for use as a blocking control in assays to test for specificity of this WNT10B antibody

Images

Immunohistochemical staining using WNT10B antibody (70R-5288)

Heart

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT10B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT10B is the ligand for members of the frizzled family of seven transmembrane receptors. WNT10B is a probable developmental protein. It may be a signaling molecule which affects the development of discrete regions of tissues. WNT10B is likely to signal over only few cell diameters.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using WNT10B antibody (70R-5288) | Heart

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors