WNT2 antibody (70R-5380)

Rabbit polyclonal WNT2 antibody raised against the middle region of WNT2

Synonyms Polyclonal WNT2 antibody, Anti-WNT2 antibody, INT1L1 antibody, WNT-2, WNT-2 antibody, WNT2, IRP antibody, WNT 2, Wingless-Type Mmtv Integration Site Family Member 2 antibody, WNT 2 antibody
Specificity WNT2 antibody was raised against the middle region of WNT2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WNT2 antibody was raised using the middle region of WNT2 corresponding to a region with amino acids GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR
Assay Information WNT2 Blocking Peptide, catalog no. 33R-3548, is also available for use as a blocking control in assays to test for specificity of this WNT2 antibody


Western Blot analysis using WNT2 antibody (70R-5380)

WNT2 antibody (70R-5380) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT2 is the ligand for members of the frizzled family of seven transmembrane receptors. WNT2 is a probable developmental protein. WNT2 may be a signaling molecule which affects the development of discrete regions of tissues. WNT2 is likely to signal over only few cell diameters.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WNT2 antibody (70R-5380) | WNT2 antibody (70R-5380) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors