WNT5A antibody (70R-6956)

Rabbit polyclonal WNT5A antibody raised against the middle region of WNT5A

Synonyms Polyclonal WNT5A antibody, Anti-WNT5A antibody, WNT5A, WNTA 5, Wingless-Type Mmtv Integration Site Family Member 5A antibody, WNTA-5 antibody, WNTA-5, hWNT5A antibody, WNTA 5 antibody
Specificity WNT5A antibody was raised against the middle region of WNT5A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WNT5A antibody was raised using the middle region of WNT5A corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
Assay Information WNT5A Blocking Peptide, catalog no. 33R-3274, is also available for use as a blocking control in assays to test for specificity of this WNT5A antibody

Images

Immunohistochemical staining using WNT5A antibody (70R-6956)

WNT5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT5A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using WNT5A antibody (70R-6956) | WNT5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using WNT5A antibody (70R-6956) | WNT5A antibody (70R-6956) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using WNT5A antibody (70R-6956) | WNT5A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors