WNT5B antibody (70R-1563)

Rabbit polyclonal WNT5B antibody raised against the C terminal of WNT5B

Synonyms Polyclonal WNT5B antibody, Anti-WNT5B antibody, Wingless-Type Mmtv Integration Site Family Member 5B antibody, WNT5B, WNTB 5, WNTB 5 antibody, WNTB-5, WNTB-5 antibody
Specificity WNT5B antibody was raised against the C terminal of WNT5B
Cross Reactivity Human
Applications WB
Immunogen WNT5B antibody was raised using the C terminal of WNT5B corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT
Assay Information WNT5B Blocking Peptide, catalog no. 33R-3537, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody


Western Blot analysis using WNT5B antibody (70R-1563)

WNT5B antibody (70R-1563) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of WNT5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WNT5B antibody (70R-1563) | WNT5B antibody (70R-1563) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors