WNT5B antibody (70R-5289)

Rabbit polyclonal WNT5B antibody raised against the middle region of WNT5B

Synonyms Polyclonal WNT5B antibody, Anti-WNT5B antibody, WNTB 5 antibody, MGC2648 antibody, WNTB 5, WNT5B, WNTB-5, Wingless-Type Mmtv Integration Site Family Member 5B antibody, WNTB-5 antibody
Specificity WNT5B antibody was raised against the middle region of WNT5B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC
Assay Information WNT5B Blocking Peptide, catalog no. 33R-10059, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody

Images

Immunohistochemical staining using WNT5B antibody (70R-5289)

WNT5B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using WNT5B antibody (70R-5289) | WNT5B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using WNT5B antibody (70R-5289) | WNT5B antibody (70R-5289) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using WNT5B antibody (70R-5289) | WNT5B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors