WNT6 antibody (70R-7182)

Rabbit polyclonal WNT6 antibody raised against the middle region of WNT6

Synonyms Polyclonal WNT6 antibody, Anti-WNT6 antibody, WNT-6, WNT6, WNT 6, WNT-6 antibody, WNT 6 antibody, Wingless-Type Mmtv Integration Site Family Member 6 antibody
Specificity WNT6 antibody was raised against the middle region of WNT6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WNT6 antibody was raised using the middle region of WNT6 corresponding to a region with amino acids ERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTG
Assay Information WNT6 Blocking Peptide, catalog no. 33R-2692, is also available for use as a blocking control in assays to test for specificity of this WNT6 antibody

Images

Western Blot analysis using WNT6 antibody (70R-7182)

WNT6 antibody (70R-7182) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The WNT family consists of several secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT6 is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The WNT6 protein overexpression may play key roles in carcinogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WNT6 antibody (70R-7182) | WNT6 antibody (70R-7182) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors