WNT7B antibody (70R-6473)

Rabbit polyclonal WNT7B antibody raised against the middle region of WNT7B

Synonyms Polyclonal WNT7B antibody, Anti-WNT7B antibody, WNTB 7 antibody, WNTB 7, WNTB-7 antibody, WNTB-7, WNT7B, Wingless-Type Mmtv Integration Site Family Member 7B antibody
Specificity WNT7B antibody was raised against the middle region of WNT7B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WNT7B antibody was raised using the middle region of WNT7B corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
Assay Information WNT7B Blocking Peptide, catalog no. 33R-10029, is also available for use as a blocking control in assays to test for specificity of this WNT7B antibody

Images

Immunohistochemical staining using WNT7B antibody (70R-6473)

Brain, cortex

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT7B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using WNT7B antibody (70R-6473) | Brain, cortex

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors