WNT9B antibody (70R-1573)

Rabbit polyclonal WNT9B antibody raised against the C terminal of WNT9B

Synonyms Polyclonal WNT9B antibody, Anti-WNT9B antibody, WNTB-9 antibody, WNTB 9, WNT9B, WNTB 9 antibody, WNTB-9, Wingless-Type Mmtv Integration Site Family Member 9B antibody
Specificity WNT9B antibody was raised against the C terminal of WNT9B
Cross Reactivity Human
Applications IHC, WB
Immunogen WNT9B antibody was raised using the C terminal of WNT9B corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD
Assay Information WNT9B Blocking Peptide, catalog no. 33R-3045, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody


Immunohistochemical staining using WNT9B antibody (70R-1573)

WNT9B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of WNT9B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using WNT9B antibody (70R-1573) | WNT9B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using WNT9B antibody (70R-1573) | WNT9B antibody (70R-1573) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors