WNT9B antibody (70R-7246)

Rabbit polyclonal WNT9B antibody raised against the middle region of WNT9B

Synonyms Polyclonal WNT9B antibody, Anti-WNT9B antibody, WNT15 antibody, WNT14B antibody, WNT9B, WNTB 9, WNTB-9 antibody, WNTB-9, Wingless-Type Mmtv Integration Site Family Member 9B antibody, WNTB 9 antibody
Specificity WNT9B antibody was raised against the middle region of WNT9B
Cross Reactivity Human
Applications WB
Immunogen WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA
Assay Information WNT9B Blocking Peptide, catalog no. 33R-1820, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody

Images

Western Blot analysis using WNT9B antibody (70R-7246)

WNT9B antibody (70R-7246) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT9B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT9B is a ligand for members of the frizzled family of seven transmembrane receptors. WNT9B is a probable developmental protein. WNT9B may be a signaling molecule which affects the development of discrete regions of tissues. WNT9B is likely to signal over only few cell diameters.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WNT9B antibody (70R-7246) | WNT9B antibody (70R-7246) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors