WWP1 antibody (70R-5902)

Rabbit polyclonal WWP1 antibody raised against the N terminal of WWP1

Synonyms Polyclonal WWP1 antibody, Anti-WWP1 antibody, Ww Domain Containing E3 Ubiquitin Protein Ligase 1 antibody, DKFZp434D2111 antibody, WWP 1, WWP-1, AIP5 antibody, WWP 1 antibody, Tiul1 antibody, WWP-1 antibody, WWP1, hSDRP1 antibody
Specificity WWP1 antibody was raised against the N terminal of WWP1
Cross Reactivity Human
Applications WB
Immunogen WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Assay Information WWP1 Blocking Peptide, catalog no. 33R-1550, is also available for use as a blocking control in assays to test for specificity of this WWP1 antibody

Images

Western Blot analysis using WWP1 antibody (70R-5902)

WWP1 antibody (70R-5902) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WWP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WWP1 antibody (70R-5902) | WWP1 antibody (70R-5902) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors