XAF1 antibody (70R-3725)

Rabbit polyclonal XAF1 antibody raised against the middle region of XAF1

Synonyms Polyclonal XAF1 antibody, Anti-XAF1 antibody, XAF1, XAF 1 antibody, BIRC4BP antibody, XAF-1 antibody, Xiap Associated Factor 1 antibody, XAF-1, XAF 1, HSXIAPAF1 antibody
Specificity XAF1 antibody was raised against the middle region of XAF1
Cross Reactivity Human
Applications WB
Immunogen XAF1 antibody was raised using the middle region of XAF1 corresponding to a region with amino acids SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC
Assay Information XAF1 Blocking Peptide, catalog no. 33R-8780, is also available for use as a blocking control in assays to test for specificity of this XAF1 antibody


Western Blot analysis using XAF1 antibody (70R-3725)

XAF1 antibody (70R-3725) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XAF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance X-linked inhibitor of apoptosis is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XAF1 antibody (70R-3725) | XAF1 antibody (70R-3725) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors