XK antibody (70R-7169)

Rabbit polyclonal XK antibody

Synonyms Polyclonal XK antibody, Anti-XK antibody, Mcleod Syndrome antibody, X-Linked Kx Blood Group antibody, X1k antibody, XKR1 antibody, KX antibody
Cross Reactivity Human
Applications WB
Immunogen XK antibody was raised using a synthetic peptide corresponding to a region with amino acids LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKE
Assay Information XK Blocking Peptide, catalog no. 33R-5017, is also available for use as a blocking control in assays to test for specificity of this XK antibody

Images

Western Blot analysis using XK antibody (70R-7169)

XK antibody (70R-7169) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using XK antibody (70R-7169) | XK antibody (70R-7169) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors