XK antibody (70R-7274)

Rabbit polyclonal XK antibody

Synonyms Polyclonal XK antibody, Anti-XK antibody, XKR1 antibody, Mcleod Syndrome antibody, X-Linked Kx Blood Group antibody, KX antibody, X1k antibody
Cross Reactivity Human
Applications WB
Immunogen XK antibody was raised using a synthetic peptide corresponding to a region with amino acids QMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLY
Assay Information XK Blocking Peptide, catalog no. 33R-7655, is also available for use as a blocking control in assays to test for specificity of this XK antibody

Images

Western Blot analysis using XK antibody (70R-7274)

XK antibody (70R-7274) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins. This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using XK antibody (70R-7274) | XK antibody (70R-7274) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors