XPO5 Blocking Peptide (33R-10360)

A synthetic peptide for use as a blocking control in assays to test for specificity of Xpo5 antibody, catalog no. 70R-8741

Synonyms XPO5 control peptide, XPO5 antibody Blocking Peptide, Anti-XPO5 Blocking Peptide, exportin 5 Blocking Peptide, FLJ14239 Blocking Peptide, FLJ32057 Blocking Peptide, FLJ45606 Blocking Peptide, KIAA1291 Blocking Peptide, XPO5, XPO-5, XPO 5, XPO-5 Blocking Peptide, XPO 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LNFLLSTLQENVNKYQQMKTDASQEAEAQANCRVSIAALNTLAGYIDWVS
Molecular Weight 132 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Exportin-5 belongs to a large family of karyopherins that mediate the transport of proteins and other cargo between the nuclear and cytoplasmic compartments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors