XRCC2 antibody (70R-5542)

Rabbit polyclonal XRCC2 antibody raised against the middle region of XRCC2

Synonyms Polyclonal XRCC2 antibody, Anti-XRCC2 antibody, XRCC 2, X-Ray Repair Complementing Defective Repair In Chinese Hamster Cells 2 antibody, XRCC-2, DKFZp781P0919 antibody, XRCC 2 antibody, XRCC2, XRCC-2 antibody
Specificity XRCC2 antibody was raised against the middle region of XRCC2
Cross Reactivity Human
Applications WB
Immunogen XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
Assay Information XRCC2 Blocking Peptide, catalog no. 33R-1740, is also available for use as a blocking control in assays to test for specificity of this XRCC2 antibody

Images

Western Blot analysis using XRCC2 antibody (70R-5542)

XRCC2 antibody (70R-5542) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRCC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using XRCC2 antibody (70R-5542) | XRCC2 antibody (70R-5542) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors