XRN1 antibody (70R-4745)

Rabbit polyclonal XRN1 antibody raised against the middle region of XRN1

Synonyms Polyclonal XRN1 antibody, Anti-XRN1 antibody, FLJ41903 antibody, XRN 1 antibody, 5'-3' Exoribonuclease 1 antibody, XRN1, DKFZp434P0721 antibody, DKFZp686B22225 antibody, SEP1 antibody, XRN 1, XRN-1 antibody, DKFZp686F19113 antibody, XRN-1
Specificity XRN1 antibody was raised against the middle region of XRN1
Cross Reactivity Human,Rat
Applications WB
Immunogen XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM
Assay Information XRN1 Blocking Peptide, catalog no. 33R-5282, is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody

Images

Western Blot analysis using XRN1 antibody (70R-4745)

XRN1 antibody (70R-4745) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 194 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using XRN1 antibody (70R-4745) | XRN1 antibody (70R-4745) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors