XTP3TPA antibody (70R-3772)

Rabbit polyclonal XTP3TPA antibody raised against the middle region of XTP3TPA

Synonyms Polyclonal XTP3TPA antibody, Anti-XTP3TPA antibody, XTPTPA-3 antibody, XTPTPA-3, Xtp3-Transactivated Protein A antibody, XTP3TPA, XTPTPA 3, RS21C6 antibody, XTPTPA 3 antibody, CDA03 antibody, MGC5627 antibody
Specificity XTP3TPA antibody was raised against the middle region of XTP3TPA
Cross Reactivity Human
Applications IHC, WB
Immunogen XTP3TPA antibody was raised using the middle region of XTP3TPA corresponding to a region with amino acids KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST
Assay Information XTP3TPA Blocking Peptide, catalog no. 33R-4552, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody

Images

Immunohistochemical staining using XTP3TPA antibody (70R-3772)

XTP3TPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XTP3TPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity and pyrimidine deoxyribonucleotide binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using XTP3TPA antibody (70R-3772) | XTP3TPA antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using XTP3TPA antibody (70R-3772) | XTP3TPA antibody (70R-3772) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors