XYLT2 antibody (70R-7170)

Rabbit polyclonal XYLT2 antibody raised against the middle region of XYLT2

Synonyms Polyclonal XYLT2 antibody, Anti-XYLT2 antibody, XYLT 2 antibody, Xylosyltransferase Ii antibody, XYLT2, XYLT 2, xylT-II antibody, XYLT-2, XYLT-2 antibody, XT-II antibody, XT2 antibody
Specificity XYLT2 antibody was raised against the middle region of XYLT2
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW
Assay Information XYLT2 Blocking Peptide, catalog no. 33R-7222, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody


Western Blot analysis using XYLT2 antibody (70R-7170)

XYLT2 antibody (70R-7170) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 97 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XYLT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XYLT2 antibody (70R-7170) | XYLT2 antibody (70R-7170) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors