YIF1B antibody (70R-6837)

Rabbit polyclonal YIF1B antibody

Synonyms Polyclonal YIF1B antibody, Anti-YIF1B antibody, YIFB 1 antibody, YIF1B, YIFB-1, YIFB 1, YIFB-1 antibody, Yip1 Interacting Factor Homolog B antibody, FinGER8 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen YIF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids LGTQDRFSPDLLGLQASSALAWLTLEVLAILLSLYLVTVNTDLTTIDLVA
Assay Information YIF1B Blocking Peptide, catalog no. 33R-4998, is also available for use as a blocking control in assays to test for specificity of this YIF1B antibody


Western Blot analysis using YIF1B antibody (70R-6837)

YIF1B antibody (70R-6837) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YIF1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YIF1B belongs to the YIF1 family. It is a multi-pass membrane protein. The functions of YIF1B remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using YIF1B antibody (70R-6837) | YIF1B antibody (70R-6837) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors