YIPF1 antibody (70R-6405)

Rabbit polyclonal YIPF1 antibody raised against the middle region of YIPF1

Synonyms Polyclonal YIPF1 antibody, Anti-YIPF1 antibody, DJ167A19.1 antibody, YIPF1, YIPF-1 antibody, FinGER1 antibody, YIPF 1, YIPF-1, YIPF 1 antibody, Yip1 Domain Family Member 1 antibody
Specificity YIPF1 antibody was raised against the middle region of YIPF1
Cross Reactivity Human
Applications WB
Immunogen YIPF1 antibody was raised using the middle region of YIPF1 corresponding to a region with amino acids HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS
Assay Information YIPF1 Blocking Peptide, catalog no. 33R-3775, is also available for use as a blocking control in assays to test for specificity of this YIPF1 antibody


Western Blot analysis using YIPF1 antibody (70R-6405)

YIPF1 antibody (70R-6405) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YIPF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YIPF1 is a multi-pass membrane protein. It belongs to the YIP1 family. The exact function of YIPF1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using YIPF1 antibody (70R-6405) | YIPF1 antibody (70R-6405) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors