YIPF6 antibody (70R-7048)

Rabbit polyclonal YIPF6 antibody raised against the C terminal of YIPF6

Synonyms Polyclonal YIPF6 antibody, Anti-YIPF6 antibody, FinGER6 antibody, Yip1 Domain Family Member 6 antibody, YIPF-6, YIPF-6 antibody, MGC21416 antibody, YIPF 6 antibody, YIPF 6, YIPF6
Specificity YIPF6 antibody was raised against the C terminal of YIPF6
Cross Reactivity Human
Applications WB
Immunogen YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL
Assay Information YIPF6 Blocking Peptide, catalog no. 33R-6602, is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody

Images

Western Blot analysis using YIPF6 antibody (70R-7048)

YIPF6 antibody (70R-7048) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YIPF6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using YIPF6 antibody (70R-7048) | YIPF6 antibody (70R-7048) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors