YWHAH Blocking Peptide (33R-1091)

A synthetic peptide for use as a blocking control in assays to test for specificity of YWHAH antibody, catalog no. 70R-10462

Synonyms YWHAH control peptide, YWHAH antibody Blocking Peptide, Anti-YWHAH Blocking Peptide, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide Blocking Peptide, YWHA1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The YWHAH gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors