ZCCHC13 antibody (70R-4279)

Rabbit polyclonal ZCCHC13 antibody raised against the middle region of ZCCHC13

Synonyms Polyclonal ZCCHC13 antibody, Anti-ZCCHC13 antibody, ZCCHC-13, ZNF9L antibody, ZCCHC-13 antibody, ZCCHC 13, ZCCHC 13 antibody, ZCCHC13, Cnbp2 antibody, Zinc Finger Cchc Domain Containing 13 antibody
Specificity ZCCHC13 antibody was raised against the middle region of ZCCHC13
Cross Reactivity Human
Applications WB
Immunogen ZCCHC13 antibody was raised using the middle region of ZCCHC13 corresponding to a region with amino acids GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS
Assay Information ZCCHC13 Blocking Peptide, catalog no. 33R-3370, is also available for use as a blocking control in assays to test for specificity of this ZCCHC13 antibody

Images

Western Blot analysis using ZCCHC13 antibody (70R-4279)

ZCCHC13 antibody (70R-4279) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZCCHC13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ZCCHC13 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZCCHC13 antibody (70R-4279) | ZCCHC13 antibody (70R-4279) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors