ZCCHC17 antibody (70R-4635)

Rabbit polyclonal ZCCHC17 antibody raised against the middle region of ZCCHC17

Synonyms Polyclonal ZCCHC17 antibody, Anti-ZCCHC17 antibody, ZCCHC-17, pNO40 antibody, RP11-266K22.1 antibody, PS1D antibody, ZCCHC-17 antibody, ZCCHC 17 antibody, HSPC251 antibody, ZCCHC17, ZCCHC 17, Zinc Finger Cchc Domain Containing 17 antibody
Specificity ZCCHC17 antibody was raised against the middle region of ZCCHC17
Cross Reactivity Human
Applications WB
Immunogen ZCCHC17 antibody was raised using the middle region of ZCCHC17 corresponding to a region with amino acids CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH
Assay Information ZCCHC17 Blocking Peptide, catalog no. 33R-1685, is also available for use as a blocking control in assays to test for specificity of this ZCCHC17 antibody


Western Blot analysis using ZCCHC17 antibody (70R-4635)

ZCCHC17 antibody (70R-4635) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZCCHC17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZCCHC17 contains 1 CCHC-type zinc finger and 1 S1 motif domain. The exact function of ZDHHC19 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZCCHC17 antibody (70R-4635) | ZCCHC17 antibody (70R-4635) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors