ZCRB1 antibody (70R-4971)

Rabbit polyclonal ZCRB1 antibody raised against the N terminal of ZCRB1

Synonyms Polyclonal ZCRB1 antibody, Anti-ZCRB1 antibody, Zinc Finger Cchc-Type And Rna Binding Motif 1 antibody, MADP-1 antibody, ZCRB 1 antibody, ZCRB-1 antibody, MGC26805 antibody, ZCRB1, ZCRB-1, RBM36 antibody, MADP1 antibody, ZCCHC19 antibody, ZCRB 1
Specificity ZCRB1 antibody was raised against the N terminal of ZCRB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS
Assay Information ZCRB1 Blocking Peptide, catalog no. 33R-6428, is also available for use as a blocking control in assays to test for specificity of this ZCRB1 antibody


Western Blot analysis using ZCRB1 antibody (70R-4971)

ZCRB1 antibody (70R-4971) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZCRB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognises the 5' splice site and branch-point sequence.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZCRB1 antibody (70R-4971) | ZCRB1 antibody (70R-4971) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors