ZDHHC14 antibody (70R-7047)

Rabbit polyclonal ZDHHC14 antibody raised against the N terminal of ZDHHC14

Synonyms Polyclonal ZDHHC14 antibody, Anti-ZDHHC14 antibody, ZDHHC 14 antibody, ZDHHC-14, ZDHHC 14, FLJ20984 antibody, ZDHHC-14 antibody, ZDHHC14, Zinc Finger Dhhc-Type Containing 14 antibody, NEW1CP antibody
Specificity ZDHHC14 antibody was raised against the N terminal of ZDHHC14
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ZDHHC14 antibody was raised using the N terminal of ZDHHC14 corresponding to a region with amino acids TLLRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVII
Assay Information ZDHHC14 Blocking Peptide, catalog no. 33R-9176, is also available for use as a blocking control in assays to test for specificity of this ZDHHC14 antibody

Images

Western Blot analysis using ZDHHC14 antibody (70R-7047)

ZDHHC14 antibody (70R-7047) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC14 belongs to the DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily. It contains 1 DHHC-type zinc finger. It is a multi-pass membrane protein. The function of ZDHHC14 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZDHHC14 antibody (70R-7047) | ZDHHC14 antibody (70R-7047) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors