ZDHHC16 antibody (70R-6644)

Rabbit polyclonal ZDHHC16 antibody raised against the C terminal of ZDHHC16

Synonyms Polyclonal ZDHHC16 antibody, Anti-ZDHHC16 antibody, ZDHHC 16, Zinc Finger Dhhc-Type Containing 16 antibody, ZDHHC-16, MGC2993 antibody, ZDHHC-16 antibody, ZDHHC 16 antibody, ZDHHC16, APH2 antibody
Specificity ZDHHC16 antibody was raised against the C terminal of ZDHHC16
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG
Assay Information ZDHHC16 Blocking Peptide, catalog no. 33R-9668, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody

Images

Western Blot analysis using ZDHHC16 antibody (70R-6644)

ZDHHC16 antibody (70R-6644) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC16 may be involved in apoptosis regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZDHHC16 antibody (70R-6644) | ZDHHC16 antibody (70R-6644) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors