ZDHHC18 antibody (70R-7061)

Rabbit polyclonal ZDHHC18 antibody raised against the middle region of ZDHHC18

Synonyms Polyclonal ZDHHC18 antibody, Anti-ZDHHC18 antibody, Zinc Finger Dhhc-Type Containing 18 antibody, ZDHHC 18, ZDHHC-18, DKFZp667O2416 antibody, ZDHHC 18 antibody, ZDHHC18, ZDHHC-18 antibody
Specificity ZDHHC18 antibody was raised against the middle region of ZDHHC18
Cross Reactivity Human
Applications WB
Immunogen ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII
Assay Information ZDHHC18 Blocking Peptide, catalog no. 33R-3066, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody

Images

Western Blot analysis using ZDHHC18 antibody (70R-7061)

ZDHHC18 antibody (70R-7061) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZDHHC18 antibody (70R-7061) | ZDHHC18 antibody (70R-7061) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors