ZDHHC18 antibody (70R-7069)

Rabbit polyclonal ZDHHC18 antibody raised against the middle region of ZDHHC18

Synonyms Polyclonal ZDHHC18 antibody, Anti-ZDHHC18 antibody, Zinc Finger Dhhc-Type Containing 18 antibody, ZDHHC 18 antibody, ZDHHC 18, ZDHHC-18, ZDHHC-18 antibody, ZDHHC18, DKFZp667O2416 antibody
Specificity ZDHHC18 antibody was raised against the middle region of ZDHHC18
Cross Reactivity Human
Applications WB
Immunogen ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK
Assay Information ZDHHC18 Blocking Peptide, catalog no. 33R-8440, is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody

Images

Western Blot analysis using ZDHHC18 antibody (70R-7069)

ZDHHC18 antibody (70R-7069) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZDHHC18 antibody (70R-7069) | ZDHHC18 antibody (70R-7069) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors