ZDHHC21 antibody (70R-4550)

Rabbit polyclonal ZDHHC21 antibody raised against the middle region of ZDHHC21

Synonyms Polyclonal ZDHHC21 antibody, Anti-ZDHHC21 antibody, ZDHHC 21 antibody, Zinc Finger Dhhc-Type Containing 21 antibody, ZDHHC 21, ZDHHC21, ZDHHC-21 antibody, ZDHHC-21
Specificity ZDHHC21 antibody was raised against the middle region of ZDHHC21
Cross Reactivity Human
Applications WB
Immunogen ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV
Assay Information ZDHHC21 Blocking Peptide, catalog no. 33R-2559, is also available for use as a blocking control in assays to test for specificity of this ZDHHC21 antibody


Western Blot analysis using ZDHHC21 antibody (70R-4550)

ZDHHC21 antibody (70R-4550) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ZDHHC21 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZDHHC21 antibody (70R-4550) | ZDHHC21 antibody (70R-4550) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors