ZDHHC24 antibody (70R-7007)

Rabbit polyclonal ZDHHC24 antibody raised against the N terminal of ZDHHC24

Synonyms Polyclonal ZDHHC24 antibody, Anti-ZDHHC24 antibody, Zinc Finger Dhhc-Type Containing 24 antibody, ZDHHC-24 antibody, ZDHHC 24, ZDHHC 24 antibody, ZDHHC24, ZDHHC-24
Specificity ZDHHC24 antibody was raised against the N terminal of ZDHHC24
Cross Reactivity Human
Applications WB
Immunogen ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML
Assay Information ZDHHC24 Blocking Peptide, catalog no. 33R-10279, is also available for use as a blocking control in assays to test for specificity of this ZDHHC24 antibody


Western Blot analysis using ZDHHC24 antibody (70R-7007)

ZDHHC24 antibody (70R-7007) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZDHHC24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ZDHHC24 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZDHHC24 antibody (70R-7007) | ZDHHC24 antibody (70R-7007) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors