Zfp472 Blocking Peptide (33R-10416)

A synthetic peptide for use as a blocking control in assays to test for specificity of Zfp472 antibody, catalog no. 70R-8410

Synonyms Zfp472 control peptide, Zfp472 antibody Blocking Peptide, Anti-Zfp472 Blocking Peptide, zinc finger protein 472 Blocking Peptide, KRIM-1 Blocking Peptide, Krim-1A Blocking Peptide, Krim-1B Blocking Peptide, Krim1 Blocking Peptide, Zfp472, Zfp-472, Zfp 472, Zfp-472 Blocking Peptide, Zfp 472 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TLGEWTMLDSSQKKLYRDVMKETFLNLISIGKTEEEDTEEEYQNPKGNLR
Molecular Weight 58 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this protein remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors