Zfp90 Blocking Peptide (33R-10338)

A synthetic peptide for use as a blocking control in assays to test for specificity of Zfp90 antibody, catalog no. 70R-7903

Synonyms Zfp90 control peptide, Zfp90 antibody Blocking Peptide, Anti-Zfp90 Blocking Peptide, zinc finger protein 90 Blocking Peptide, 6430515L01Rik Blocking Peptide, KRAB17 Blocking Peptide, NK10 Blocking Peptide, Zfp64 Blocking Peptide, Zfp83 Blocking Peptide, mKIAA1954 Blocking Peptide, Zfp90, Zfp-90, Zfp 90, Zfp-90 Blocking Peptide, Zfp 90 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues HLVSLGYQVSKPEVIFKLEQGEEPWISEKEIQRPFCPDWKTRPESSRSPQ
Molecular Weight 72 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Zfp90 may function as a repressor or silencer protein, and most likely exerts its repressing activity upon zinc-dependent binding to DNA. It may be involved in proper spermatogenesis by repressing the expression of genes unnecessary or incompatible with the maintenance of a haploid cell state.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors