ZMPSTE24 antibody (70R-7342)

Rabbit polyclonal ZMPSTE24 antibody

Synonyms Polyclonal ZMPSTE24 antibody, Anti-ZMPSTE24 antibody, STE24 antibody, Ste24p antibody, ZMPSTE 24, ZMPSTE24, Ste24 Homolog S. Cerevisiae antibody, ZMPSTE 24 antibody, FACE1 antibody, FACE-1 antibody, ZMPSTE-24, ZMPSTE-24 antibody, FLJ14968 antibody, Zinc Metallopeptidase antibody
Cross Reactivity Human
Applications WB
Immunogen ZMPSTE24 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATL
Assay Information ZMPSTE24 Blocking Peptide, catalog no. 33R-5572, is also available for use as a blocking control in assays to test for specificity of this ZMPSTE24 antibody

Images

Western Blot analysis using ZMPSTE24 antibody (70R-7342)

ZMPSTE24 antibody (70R-7342) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZMPSTE24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZMPSTE24 is a member of the peptidase M48A family. This protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in ZMPSTE24 gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZMPSTE24 antibody (70R-7342) | ZMPSTE24 antibody (70R-7342) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors