ZNF12 Blocking Peptide (33R-1086)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF12 antibody, catalog no. 20R-1180

Synonyms ZNF12 control peptide, ZNF12 antibody Blocking Peptide, Anti-ZNF12 Blocking Peptide, zinc finger protein 12 Blocking Peptide, ZNF12, ZNF-12, ZNF 12, ZNF-12 Blocking Peptide, ZNF 12 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILE
Molecular Weight 77 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Two members of the human zinc finger Kruppel family, ZNF 12 (KOX 3) and ZNF 26 (KOX 20), have been localized by somatic cell hybrid analysis and in situ chromosomal hybridization. The presence of individual human zinc finger genes in mouse-human hybrid DNAs was correlated with the presence of specific human chromosomes or regions of chromosomes in the corresponding cell hybrids. Analysis of such mouse-human hybrid DNAs assigned the ZNF 12 (KOX 3) gene to chromosome region 7p.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors