ZNF14 antibody (70R-3249)

Rabbit polyclonal ZNF14 antibody raised against the N terminal of ZNF14

Synonyms Polyclonal ZNF14 antibody, Anti-ZNF14 antibody, ZNF14, ZNF-14 antibody, ZNF 14 antibody, ZNF-14, ZNF 14, KOX6 antibody, GIOT-4 antibody, Zinc Finger Protein 14 antibody
Specificity ZNF14 antibody was raised against the N terminal of ZNF14
Cross Reactivity Human,Mouse
Applications WB
Immunogen ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC
Assay Information ZNF14 Blocking Peptide, catalog no. 33R-4231, is also available for use as a blocking control in assays to test for specificity of this ZNF14 antibody

Images

Western Blot analysis using ZNF14 antibody (70R-3249)

ZNF14 antibody (70R-3249) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZNF14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZNF14 antibody (70R-3249) | ZNF14 antibody (70R-3249) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors