ZNF19 antibody (70R-2140)

Rabbit polyclonal ZNF19 antibody raised against the N terminal of ZNF19

Synonyms Polyclonal ZNF19 antibody, Anti-ZNF19 antibody, Zinc Finger Protein 19 antibody, KOX12 antibody, MGC51021 antibody, ZNF19, ZNF 19,ZNF-19,ZNF 19 antibody, ZNF-19 antibody
Specificity ZNF19 antibody was raised against the N terminal of ZNF19
Cross Reactivity Human
Applications WB
Immunogen ZNF19 antibody was raised using the N terminal of ZNF19 corresponding to a region with amino acids TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE
Assay Information ZNF19 Blocking Peptide, catalog no. 33R-8978, is also available for use as a blocking control in assays to test for specificity of this ZNF19 antibody


Western Blot analysis using ZNF19 antibody (70R-2140)

ZNF19 antibody (70R-2140) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZNF19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZNF19 antibody (70R-2140) | ZNF19 antibody (70R-2140) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors